PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676770638
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family Whirly
Protein Properties Length: 243aa    MW: 26661.8 Da    PI: 10.534
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676770638genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly2072.2e-64632011139
     Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlp 100
                +++k+kaal+v++v+p+f++++ gnl+++r+G++++++++a++erkydWekkq fals+tev++l+++++++s+effhdp++k+sn+G+vrk+l+++Pl+
  676770638  63 AIFKGKAALSVEPVLPSFTKIEPGNLRIDRRGSVMMTFMPAVGERKYDWEKKQLFALSPTEVGSLISMGPQDSSEFFHDPSMKSSNAGQVRKSLSIKPLA 162
                59************************************************************************************************** PP

     Whirly 101 dGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                d +G+f++l+vtns++++ ++++vPvskaefavl+s+++
  676770638 163 DSTGYFFQLTVTNSILNSVDRMVVPVSKAEFAVLKSAFS 201
                ************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.101.0E-7252215IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544472.35E-6556215IPR009044ssDNA-binding transcriptional regulator
PfamPF085365.9E-6064199IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MMKQARTLLS RSLCAQSKSL FQGNLRSPAS RGFATWEDSS PTKRGFSGKD AAKPTGRVFA  60
PYAIFKGKAA LSVEPVLPSF TKIEPGNLRI DRRGSVMMTF MPAVGERKYD WEKKQLFALS  120
PTEVGSLISM GPQDSSEFFH DPSMKSSNAG QVRKSLSIKP LADSTGYFFQ LTVTNSILNS  180
VDRMVVPVSK AEFAVLKSAF SFALPHIMGW DRITRGDVGI AAQGITSLPK ADPMKLELEW  240
AKE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4kop_A1e-100492142167Single-stranded DNA-binding protein WHY2, mit
4kop_B1e-100492142167Single-stranded DNA-binding protein WHY2, mit
4kop_C1e-100492142167Single-stranded DNA-binding protein WHY2, mit
4kop_D1e-100492142167Single-stranded DNA-binding protein WHY2, mit
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013649459.11e-153PREDICTED: single-stranded DNA-binding protein WHY2, mitochondrial-like isoform X2
SwissprotQ8VYF71e-124WHY2_ARATH; Single-stranded DNA-binding protein WHY2, mitochondrial
TrEMBLA0A0D3CZT61e-152A0A0D3CZT6_BRAOL; Uncharacterized protein
STRINGBra016150.1-P1e-151(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM123582731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.11e-125WHIRLY 2